SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000035350 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000035350
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-33
Family Nuclear receptor ligand-binding domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000035350   Gene: ENSCING00000024957   Transcript: ENSCINT00000030933
Sequence length 128
Comment pep:known chromosome:KH:10:2060829:2062483:-1 gene:ENSCING00000024957 transcript:ENSCINT00000030933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVDQIVLLRGGCLEMLVLRSYFAFSCNENKYMSDKFQYKPSDFLQAGGNKEFVEKYNSLH
IRMRKMKLQVEEICLLLALVLFSPDRPGLEDQAKVEQMQDCVANTLQAYEYTHKPPNEVK
QCYFMYLK
Download sequence
Identical sequences H2Y0B6
ENSCINP00000035350 7719.ENSCINP00000025480 ENSCINP00000035350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]