SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000035869 from Ciona intestinalis 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000035869
Domain Number 1 Region: 223-514
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-60
Family Nuclear receptor ligand-binding domain 0.000000451
Further Details:      
 
Domain Number 2 Region: 173-250
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.28e-25
Family Nuclear receptor 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000035869   Gene: ENSCING00000018200   Transcript: ENSCINT00000034774
Sequence length 515
Comment pep:known scaffold:KH:HT000166.1:176415:179902:1 gene:ENSCING00000018200 transcript:ENSCINT00000034774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSLLNSDDTLSSMLFIKQEPCSPLESSVNFNSSFNSSLSSSPESLCSDGGTYSPPTMVH
FGFPALFPSMPSPGDISSHFNSNFNNNRATSSGEEDVFEDFSSCMTSSESCSGEGLAGLM
PPSLSEYKSGIDSCDADSVLALVPPTSLVLKSPTTSESTGTPAPLSSSSTPPKRLCLVCG
DIASGYHYGVASCEACKAFFKRTIQGSIDYTCPAANDCEITKRRRKSCQSCRFSKCLRVG
MLREGVRLDRVRGGRQKYKRKIDANEMPYLVAVPAAAEPAPNVLSPNKILSHLLMAEPDK
LFAPHDHSATRSEISILTALCDLADRELVVIIGWAKHIPGFTVLSLADQMALLQSAWMEV
LVLGIVFRSLSRDGDLVIAEDFILDAENCAEVGMVELYHYLNQLQRRLKQLNFKKEEFVL
MKAIALVNSDSLHVENHQTLRQLQDTLLQTLSDTVQSTPSNTATTFAFQRCGQLLLTLPL
LRLAAVKAVHFFNTVRQSGKVVLHKLFLEMLDAKL
Download sequence
Identical sequences H2Y1T5
ENSCINP00000035869 ENSCINP00000035869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]