SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CLUT_05802 from Candida lusitaniae ATCC 42720

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CLUT_05802
Domain Number 1 Region: 56-106
Classification Level Classification E-value
Superfamily WWE domain 0.00000471
Family WWE domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CLUT_05802
Sequence length 475
Comment | CLUG_05802 | Candida lusitaniae hypothetical protein (476 aa)
Sequence
MLRSFPLQQASWSFFRRLSSQSPKIKWYHNTDVPLSKPSWYEYKPEAEPKAFVPFNETDS
KRLEQAFQAEKPSVDVKEDQLFVVDLQKMQLAPIYWPGPVFEVRRGKWFTSGGKPLSQEM
TLKLDQAYEAIQPVEKPEDDEAEFAAEFAKSPANAVARLNKMASEQINSNPIDFAKEKDV
YNLGGGQAVIFFDETHGALFPDSLTSFQLNVLRSFSTSSSSLPSITMIQRGHTDDLDTSV
LQSVTSASVPSLSNIFQKELNKLFSKESTLGDTENGPEQEKVLQEVMEVDLDAENTVSEK
RNVDHLLLCVHGIGQILGYKYESVNFTHSINVLRNTMRHVYQTEPKYQEIAYGENFDEKN
EQQKGNNRIQILPVSWRHNVSFHPRKPFDLKNEKGEPRLPSLGEINVDGVKALRNVVGDV
VLDVLLYYEARYLKEIFKSVVAELNRVYHLFKEKNPRFQRQGACFRPLFGLGHCF
Download sequence
Identical sequences C4YCG3
XP_002614316.1.3285 CLUT_05802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]