SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PADG_06732T0 from Paracoccidioides brasiliensis Pb18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PADG_06732T0
Domain Number 1 Region: 423-539
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-16
Family UBX domain 0.018
Further Details:      
 
Domain Number 2 Region: 200-347
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000188
Family UAS domain 0.062
Further Details:      
 
Weak hits

Sequence:  PADG_06732T0
Domain Number - Region: 12-46
Classification Level Classification E-value
Superfamily UBA-like 0.00316
Family TAP-C domain-like 0.027
Further Details:      
 
Domain Number - Region: 311-421
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0222
Family Outer membrane efflux proteins (OEP) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PADG_06732T0
Sequence length 560
Comment | PADG_06732 | Paracoccidioides brasiliensis Pb18 UBX domain-containing protein (561 aa)
Sequence
MSTEAIDISQLSPSQQTTLQTYIAVTGQDESAAVPLLQRSEWNVQVIMFLGPVSKIQSGN
AACQRFLLQIAITKFFDGEVPDPVAEAQAAMDTPPAYPSRITRNLMNGDDDDIPLSSYYA
RRTAELAPRITSQPVDQPVYRPPFLPAILFTPLSLLYKLLISSFRLFGALFPFLPRLLSN
FAAAGVQGARRDTSGRRPLGPKDSALRFIREFEEEYGSHAVPFLENGYNMALEKAHQELK
YLLVILLSPEHDDTSSWIRDTILSKEVVDFINDSSNQILVWAGNVRDSEAYQVASGLRCT
KFPFFGLIVHNPNVSATAMSVVAKASGFTTPSELIEKLRSAITQSQAPLDRVRATRAEQR
ASRTIRQEQDSAYERSLAQDRERARQRRAAEEARQREENEARERRAAAEKLARYLEQWKR
WRVQSLPHEPPATDKQAVRLSIRLASGDRVIRRFSGSADIEELYAFVECYDILHADGDGS
ESSSSGASQPPPDGFEHKYGFRLVSPMPRVVYEVNAGGSVGEKIGRGGTLLVETIDDDDD
DDGDGEDDGDDSDPDGAQSS
Download sequence
Identical sequences PADG_06732T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]