SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_00058 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_00058
Domain Number 1 Region: 79-163
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-23
Family APG12-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_00058
Sequence length 164
Comment | CAWG_00058 | Candida albicans WO1 conserved hypothetical protein (165 aa)
Sequence
MSRIIHSEDDDDDDVGSQSSSSLSSPSKSLQQDPIPTKIPLSTSIILEKKSPLEQHQKLS
NPTEGSTAGGHVSNNSLDNKIMIRFVPIGSTPSIQPRVFKISATQTVSTLNRFLCKKLKF
KGVLNLYIQNSFMPLPDEQIGSLYGLFKTNNELIISYCNTIAFG
Download sequence
Identical sequences C4YFT2
CAWT_00058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]