SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_00253 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_00253
Domain Number 1 Region: 23-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000154
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_00253
Sequence length 140
Comment | CAWG_00253 | Candida albicans WO1 conserved hypothetical protein (141 aa)
Sequence
MPIKAIPKVSIARNGIGAFVNPCHRITVQYCNWGGSSTHLRELLTNGGLNNYAKSKPDIF
FEIKQLRGHPKLIFHYNNNVTKEVEIKNIKQNEIIKTLTEYSQRSGNELFKFNHKVKSIN
DSVRGIWSPLQVPKGYRHKI
Download sequence
Identical sequences C4YCL9 Q5A3J1
5476.CAL0003624 XP_716348.1.88832 CAWT_00253 CA4973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]