SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_00303 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_00303
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.77e-23
Family Ubiquitin-related 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_00303
Sequence length 102
Comment | CAWG_00303 | Candida albicans WO1 hypothetical protein similar to suppressor of MIF2 mutations (103 aa)
Sequence
MSDTENTGGSPPAAEAGPKEEKGTHINVKVSDGTQEVFFKVKRNTKFRRLMEAFAKRQGT
SPDTMRFLVDGGRVHADQTPEDLDMDDGDTIEAHRAQIGGCL
Download sequence
Identical sequences C4YCR9 Q59W54
CA4105 5476.CAL0001089 CAWT_00303 XP_713803.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]