SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_00656 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_00656
Domain Number 1 Region: 42-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-32
Family Thioltransferase 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_00656
Sequence length 175
Comment | CAWG_00656 | Candida albicans WO1 hypothetical protein similar to glutaredoxin (176 aa)
Sequence
MFRRSLLSTSRFINKSSSSLSPGLLLNNFRGNFQQSRFISTELKDALDKAVTTSPVVLFM
KGTPEFPQCGFSRATIQILGQQGVDPEKFAAYNVLEDSELREGIKEYSSWPTIPQLYVNG
EFIGGCDIITSMAQNGELAELLEKSNALIPEENEPTTSEENQETVQSANIKPNRN
Download sequence
Identical sequences C4YDQ9
CAWT_00656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]