SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_00860 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_00860
Domain Number 1 Region: 25-182
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.72e-27
Family Glutathione peroxidase-like 0.0000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_00860
Sequence length 184
Comment | CAWG_00860 | Candida albicans WO1 hypothetical protein similar to AhpC/TSA family protein (185 aa)
Sequence
MFSFTRAVPKSQLRFTVRNSLRTYVSIGDKVPATPVFEGSPGNDINLAEETASGKTILIG
VPGAFSPACSASHVPGYIKNIRAFNDKGYQRFFVVAVNDPFVTKAWGEQLLESVAGQQIR
FFADSTGAFTKELDLLFDARKAFGNERSKRYALIIEDGKVVKSFVEPDNTSVDVSAAQKV
LEEA
Download sequence
Identical sequences C4YEA5
CAWT_00860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]