SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_01417 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_01417
Domain Number 1 Region: 71-211
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-48
Family Ran-binding domain 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_01417
Sequence length 212
Comment | CAWG_01417 | Candida albicans WO1 ran-specific GTPase-activating protein 1 (213 aa)
Sequence
MSAEDTKPKTEESSSIPKPPTSNVFSMFGAKKEKKPEQEDSDNKKESDKKEEKDTSKSTG
DDNEVAEEEEADVEFTPVVQLDKKVDVKTNEEDEEVLYKVRAKLFRFHGDSKEWKERGTG
DVKFLKHKTTGKVRILMRRDKTLKICANHLISADYELKPNIGSDRSWVYTVTADVSEGEP
EAQTLAIRFGNKENADLFKEHFDNAKKEAKKD
Download sequence
Identical sequences C4YNF7 Q9HF92
CAWT_01417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]