SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_02636 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_02636
Domain Number 1 Region: 15-115
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000505
Family Glutathione S-transferase (GST), C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_02636
Sequence length 128
Comment | CAWG_02636 | Candida albicans WO1 conserved hypothetical protein (129 aa)
Sequence
MVHGVAKKKAPFGARFLMGLLMGSIDDAFYIPDLKKNLKYLENIIHKQHEKGSKYFVGDK
LSGADIILEFPVITNIFQNKRGAEQLGAGDVEKEYPHLNQWAEDIKKEPKYIKAQELVAK
HETVKPNI
Download sequence
Identical sequences C4YQ80
CAWT_02636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]