SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_02662 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_02662
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-25
Family Ubiquitin-related 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_02662
Sequence length 77
Comment | CAWG_02662 | Candida albicans WO1 hypothetical protein similar to GLP_49_81391_81639 (78 aa)
Sequence
MQIKVKTLTGRDMPLDVEPQDKIIRIKEMMEEKEGISPAQQRLIFNGSQLNDDQTVQEAG
IQAGASLHLVLTLRGGN
Download sequence
Identical sequences A0A1D8PJP6 B9WDT9 C4YQA6
XP_002419256.1.45354 XP_019330848.1.88832 CA3378 Cd36_83270 5476.CAF0006894 573826.CD36_83270 CAWT_02662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]