SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_02689 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_02689
Domain Number 1 Region: 92-236
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.17e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 4-94
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000032
Family Glutathione S-transferase (GST), N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_02689
Sequence length 249
Comment | CAWG_02689 | Candida albicans WO1 conserved hypothetical protein (250 aa)
Sequence
MSDTKIIVHWLNYSRSQRVIWLLEELNIPFELKVYLRNKQFRAPKELENVHPLGKSPVIE
VIDTKTGESEVIAETGHIFNYILSNYDTTNILTPANRKLQNQVDYFLHYAEGTLQPNLVA
LLVHGFAKQQAPFGTKFLMGLLVNGIDSMFYIPELKKNLNYLEDIMRKQHENGSNYFVGD
KLSGADIILEFPVITNIFQNKRGAEQLGAGDVEKEYPHLNQWAEDIKKEPKYIKAQELVA
KHETVKPNI
Download sequence
Identical sequences A0A1D8PJR2 C4YQD2
5476.CAL0000275 CAWT_02689 XP_019330853.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]