SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_02873 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_02873
Domain Number 1 Region: 101-246
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.09e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 14-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000298
Family Glutathione S-transferase (GST), N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_02873
Sequence length 267
Comment | CAWG_02873 | Candida albicans WO1 conserved hypothetical protein (268 aa)
Sequence
MTMDTPNHQLEDRFILHWLDDSRSHRILWILDLLNLDYEVKIYLRHPETWRGPLQLFDAH
QLGKAPVLEVIFGDGRPPIKISESGFIIQYLLRYYDCQNILYPANLDQQLEVDYYLHYSE
GSLQHIQMALLINSSAKHIAPFATKSVVKLVTKAINNGYYKHEWFLNMKYLEDRLEQNGT
GFFVGDKLSGADVILSFPIYENVFDNLEGTKEILGDKVNIKKMFPNLFNWSRMIKNNLSY
KKITELMNEEVEDLIALNPRFDYGREK
Download sequence
Identical sequences A0A1D8PK99 C4YNU0
CA5044 CAWT_02873 5476.CAL0000420 XP_714704.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]