SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_02910 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_02910
Domain Number 1 Region: 250-412
Classification Level Classification E-value
Superfamily eEF1-gamma domain 9.68e-65
Family eEF1-gamma domain 0.0000213
Further Details:      
 
Domain Number 2 Region: 66-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0000429
Further Details:      
 
Domain Number 3 Region: 1-70
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000209
Family Glutathione S-transferase (GST), N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_02910
Sequence length 412
Comment | CAWG_02910 | Candida albicans WO1 elongation factor 1-gamma 1 (413 aa)
Sequence
MSQGTLYVTQQIRSLAPKALVKHFKLDIKLSDKDEAFNKAFPLNKIPAFIGPKGFKLTEV
IAVCLYLINLADPKSKLLGKNAVEYSQILRWLSLANTELLPTEARVFQPLNGTIPYNKKQ
VDDNSAYLAKVVDIFEKRLADFTYLVGERLTFADIFAATLFVRGFDFLFGKEWRKQHPNT
TRWFKTIIATPILAEFLGDYSFIEKPIEYVPPKKEKKKDAAPKKDAAAAPKKKEAAAPAA
SEEPAPAPKPKHPLEALGKPKNPLDEWKRTYSNEETREVAIPWFWKNQYDPEEWSLWKVD
YKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCMVVYGENNNNGITGAFLVRGQDYVPA
FDVAPDWESYEFTKLDGSNEEDKKFINNMFAWDEPVVVNGEKREIADGKVFK
Download sequence
Identical sequences A0A1D8PKC3 C4YNX7
CAWT_02910 XP_019330876.1.88832 5476.CAL0004797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]