SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_03139 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_03139
Domain Number 1 Region: 106-243
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.06e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 36-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.79e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_03139
Sequence length 245
Comment | CAWG_03139 | Candida albicans WO1 conserved hypothetical protein (246 aa)
Sequence
MLPQFHLPKKKRVYKGGNRSHTLVICLLCKDNLNKSMKLYTAPTGNGRKPLIFLHILDVP
NEIHMFDWPTKEIKENWYLELNPHGLVPTLVDGDVTLCESNAILQYLADNYDTENKFSYP
STDPLYWQQLRWLFYQSTQFSDALSRLFFYKKFRSDDQWLVDKGFEQIGKVYQVLDSHLA
QRKWFVGDKFTIADLAFAVGHFRRIEKTTGTKFEIENFEEKYPHVTQWYNDVLSIEGIKE
GFELK
Download sequence
Identical sequences C4YGG3
5476.CAL0002257 CAWT_03139 CA4392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]