SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_03527 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_03527
Domain Number 1 Region: 154-244
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.05e-27
Family Thioltransferase 0.00034
Further Details:      
 
Domain Number 2 Region: 3-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.29e-23
Family Thioltransferase 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_03527
Sequence length 253
Comment | CAWG_03527 | Candida albicans WO1 monothiol glutaredoxin-3 (254 aa)
Sequence
MGVIEIESEQQFTELTKADPSKLIALYFHTPWAGPCKTMNQVFKTLADSKESDNSIIFLS
INADELPEISEIFEVSAVPYFILIRNQTILKELSGADPKEFIQALNQFSNNTNSTTTSNN
DNVQASINSTTANTNSNNTTTNAPEVEESEEALNERLNKLTKAAPIMLFMKGSPSSPQCG
FSRQLVAILREHQVRFGFFDILKDDSVRQGLKKFSDWPTFPQLYINGEFQGGLDIIKESI
EDDEKFFEHALEA
Download sequence
Identical sequences C4YHI1 Q5AF81
CA1161 XP_720477.1.88832 CAWT_03527 5476.CAL0004203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]