SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_03554 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_03554
Domain Number 1 Region: 32-172
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.1e-26
Family Glutathione peroxidase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_03554
Sequence length 176
Comment | CAWG_03554 | Candida albicans WO1 hypothetical protein similar to peroxisomal protein (177 aa)
Sequence
MTDGKFPTNIEPKYIPYSKDHASLTACANPIPLDLKSLFPNNTVVVTAVPGAFTPTCTEQ
HIPDYLKHLKDFKDKGVKKIIVLSANDPFVMAAWAKALGYTDEENYVIFATDPNASISKE
LGDGFVADLTSAGMGLRLQRYASIVVNGEITYLETEDSLGFSEISSAETILKRIHN
Download sequence
Identical sequences C4YHK7 Q5AF44
CAWT_03554 CA4127 5476.CAL0004253 XP_720512.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]