SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_03638 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_03638
Domain Number 1 Region: 18-123,168-201
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000108
Family DsbC/DsbG C-terminal domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_03638
Sequence length 224
Comment | CAWG_03638 | Candida albicans WO1 conserved hypothetical protein (225 aa)
Sequence
MISPKYSATHYYLSAKALSGAKTAPHIINLYLDYNCPFSAKLFLKLYNTVIPNLEKTHPG
RFQFVFVNVIQPWHTNSNLLTEFALAYAKLLREKETEVDGDIDSIKAFWDFSEKLFENKE
KFYDTANIELTRNQIYEQIYNVVTSGLELKVSKEKILTELIIKPSEVPSNAGNGATADVK
YFTKYLRGVGVHVTPTVSIDGIVDDSVSSGSSEDDLVKLFESKL
Download sequence
Identical sequences A0A1D8PLE6 C4YHT6
XP_722711.1.88832 5476.CAL0003680 CAWT_03638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]