SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_03820 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_03820
Domain Number 1 Region: 46-207
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-54
Family NQO2-like 0.0000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_03820
Sequence length 243
Comment | CAWG_03820 | Candida albicans WO1 hypothetical protein similar to YlNUHM (244 aa)
Sequence
MLARFIGKSTTTPVGVYASTVSKRYSSIISVHRDTKEDNPNIAFEFNSENKKRAEEIIAK
YPPQYKKGACMPLLDLGQRQLGFTSISVMNYVAKLLDMPPMRVYEVATFYTMYNRHPMGK
YNLQVCTTTPCQLCGSDSIMKAITDYLKIKPGQTTPDKLFTLQEVECLGACVNAPMIAIN
DDYHEDLSPEATINLLKQLQEGKELTEIGPVDGKRQSCEPFSGPKVLLNKEPNDIRKFTR
ADL
Download sequence
Identical sequences C4YJ08
CAWT_03820 CA4810 5476.CAL0004559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]