SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_04059 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_04059
Domain Number 1 Region: 109-179
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 4.45e-17
Family AN1-like Zinc finger 0.0031
Further Details:      
 
Domain Number 2 Region: 1-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000313
Family Ubiquitin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_04059
Sequence length 185
Comment | CAWG_04059 | Candida albicans WO1 conserved hypothetical protein (186 aa)
Sequence
MKVTIRLSTESSFSVTIPDNATVDDLKQSIKVGLPADITLPPDFKVIYNGSKLQPYYAEL
QSFGMKSAEDNSYTVIVMSDNVDTPPITPQQSVESLAKSSTTTTTTTTTNATIKKTKKKS
RCAFHNCNSAPLRMVGTCTHCQGKFCAKHRLLEDHMCTGLQYCKDNAHEKNAMKLQSERT
IANRV
Download sequence
Identical sequences A0A1D8PGQ5 C4YJP1
XP_715354.1.88832 5476.CAL0002273 CAWT_04059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]