SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_04484 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_04484
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.67e-24
Family Thioltransferase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_04484
Sequence length 118
Comment | CAWG_04484 | Candida albicans WO1 conserved hypothetical protein (119 aa)
Sequence
MLQNIETKPQFSSALQNKNDMIVLDFFDECSHCSDLNDKLDEFSDMYEAQNIRFYKVNIE
EDRELAEDYKVSSIPTTLFFKKGKVFDKVVGPEPNEIKKVLDKNLMGWSGRPSQSSRT
Download sequence
Identical sequences C4YQY7
CAWT_04484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]