SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_04485 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_04485
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.45e-30
Family spliceosomal protein U5-15Kd 0.00000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_04485
Sequence length 148
Comment | CAWG_04485 | Candida albicans WO1 mitosis protein dim1 (149 aa)
Sequence
MGSVFLPHLKTAWHVDQAILSEDDRVVVIRFGREEETQCMIMDEILFSISEKIKNFAVVY
LVNLDKVPDFNQMYELDQNPLEPFTIMFFYRNKHMMCDFGTGNNNKLNFMIYDKQEMIDI
IETVYRGARKGKGLVMSPKDYSRSAKDI
Download sequence
Identical sequences C4YQY8 Q5A1M0
CA0468 5476.CAL0002672 XP_715737.1.88832 CAWT_04485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]