SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_04543 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_04543
Domain Number 1 Region: 117-214
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.59e-21
Family Thioltransferase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_04543
Sequence length 229
Comment | CAWG_04543 | Candida albicans WO1 conserved hypothetical protein (230 aa)
Sequence
MAGVRQLRIIALTAFVLGLIFTLHKVGSNAASLVHAQASDQQPNKHNTKSTTYTATNDES
VANLIDSKNDPQTDDKINQKISQDQDEAINGNKDTNKDTTKVKPDNGEYDPISDLIKIRS
LSPMTIFSKSYCPYSKKIKQLLLEKYDITPAPNVVELDRYEYGAELQSYLTEKSGRRTVP
NVLVGKSFESRGGCDEFEKLHKDNDLIKLLVEWGSGRLQVAKKNTPSNA
Download sequence
Identical sequences C4YR44 Q59NQ2
5476.CAL0005739 CA3083 XP_711354.1.88832 CAWT_04543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]