SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_04574 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CAWT_04574
Domain Number - Region: 86-165
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00709
Family Ubiquitin-related 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_04574
Sequence length 224
Comment | CAWG_04574 | Candida albicans WO1 conserved hypothetical protein (225 aa)
Sequence
MSTATALETTNAEKKFVNTYLELMQLSKNESLDKFNSTQDYNNLSSLGPSLPKCNYKFPE
PQNVTKAAESTVTLKFKSIKPPFKFQTELSNIPVNFTIYKVKAQLIESLEILHNAGVTAK
DLKLMIKSKVAQDAAALSSLVNTEEPISFNCMVSAPSGGKPAAATSKTDEGDPELEAVSD
PVSTTATTSSISEAGWNKIYEIILQDIKDAGKAKELLAKLKQSV
Download sequence
Identical sequences C4YR75
CAWT_04574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]