SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_04703 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_04703
Domain Number 1 Region: 71-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.95e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.00068
Further Details:      
 
Domain Number 2 Region: 1-73
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000585
Family Glutathione S-transferase (GST), N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_04703
Sequence length 219
Comment | CAWG_04703 | Candida albicans WO1 conserved hypothetical protein (220 aa)
Sequence
MSQGILYVLKLSPRSSILTDLIKYYKLDIEISTDTESESFIEKFPLRKTPTFIGNDGFQL
TETIAIGIYFLSMIPNHDLLGDNDQEFASIIRFLSMLNQEGAMSWVGAFFRLSGRLPYNK
EIIDENLITLDIIGQILDKRLANDRISGYLVGDKISYADLYGVKLFGIALYTLLGEPYLT
KYPNFAKWFKRASDNEFFRGQYKDIKFPQQQLTYPGSED
Download sequence
Identical sequences C4YRK3
CAWT_04703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]