SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_04806 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_04806
Domain Number 1 Region: 26-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.76e-28
Family PDI-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_04806
Sequence length 299
Comment | CAWG_04806 | Candida albicans WO1 conserved hypothetical protein (300 aa)
Sequence
MIFNYLLALFQILVLASARAQADEYASDPNIFELTPSNFDKVVHKSNYTTLVKFYAPWCG
YCQKLQPVYHKLGKYINKDAKYSINIASVNCDKDYNKQLCSQYQVRGFPTLMVFRPPKYE
KGKQVKLQKHASEVYQGERTVKSITKFLTSRLKNYVKKFHNIRSDGIAEWLAEDIPSVLL
ISNANSVSPLLKSIAIDFLDRVNVGMISKFNDESHKFVIGDKEIEVPATSKSSLFYFNKE
KGELVAYTKSDKLNDKIKITEWIIEQTQQQPIEGPLSKKEKKYYYKYRTGKKKIEHDEL
Download sequence
Identical sequences A0A1D8PNX4 C4YRU9
5476.CAL0002895 CA2235 CAWT_04806 XP_721830.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]