SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_05274 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_05274
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.38e-60
Family Glutathione peroxidase-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_05274
Sequence length 161
Comment | CAWG_05274 | Candida albicans WO1 hypothetical protein similar to phospholipid glutathione peroxidase (162 aa)
Sequence
MSDFYEFAPNDIKGTPYSFKKLQGKVVLIVNVASKCGFTPQYKGLEELNKKFADQPVQIL
GFPCNQFGHQEPGSNEEIGSFCSLNYGVTFPVLDKIEVNGDNTDPVYKYLKSQKSGVLGL
TRIKWNFEKFLIDQNGKVIERFSSLTSPESIGTKIEELLKK
Download sequence
Identical sequences CAWT_05274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]