SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_05469 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_05469
Domain Number 1 Region: 10-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-17
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_05469
Sequence length 92
Comment | CAWG_05469 | Candida albicans WO1 conserved hypothetical protein (93 aa)
Sequence
MSKFVIPTALKELRFHLSQTGEASIPVRNFLTKNYPSLKTQSNYKLPILIRESYGIPPTL
TARFERGEEVKTSLEGLDEAGVEKALNELLKR
Download sequence
Identical sequences A0A1D8PQU3 B9WK05 C4YTH6 Q3MPM2
CA4580 XP_002421322.1.45354 XP_019331026.1.88832 5476.CAF0007115 573826.CD36_71020 CAWT_05469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]