SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_05557 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_05557
Domain Number 1 Region: 23-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.69e-27
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_05557
Sequence length 123
Comment | CAWG_05557 | Candida albicans WO1 conserved hypothetical protein (124 aa)
Sequence
MSSILAWGFNLWYQPPPPTAQTEKEIEHTINSHKIVIYSKTYCPFCDQTKHLLNEQYPQE
SYEVINLNILDDGLTIQNQLYANTGQYMVPIIFINGQHVGGNSEVQQLHTNGKLQELLNP
QKY
Download sequence
Identical sequences A0A1D8PR08 C4YTR2
5476.CAL0003068 CAWT_05557 XP_721348.2.88832 CA4963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]