SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_05588 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_05588
Domain Number 1 Region: 47-182
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000108
Family Glutathione peroxidase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_05588
Sequence length 185
Comment | CAWG_05588 | Candida albicans WO1 conserved hypothetical protein (186 aa)
Sequence
MSFKEGSKFPAGVEFSYIPIQLDDLELINPLKCDVASQLKLDNLLTKLSTTDTPNLLIVS
VPGAFTPTCTESHLPPYLENLAKLHDKKIGAIVVLATNDQFVVNAWGKVLIKAYVKTSGK
FPEVIFASDGGFSEKYGLAGDRGGIIRNKRYAAVIDSKTKDVVYLGVETEKGVQSSGIDA
VLAKL
Download sequence
Identical sequences A0A1D8PR39 C4YTU3
XP_721312.2.88832 CAWT_05588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]