SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_05637 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_05637
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-31
Family YKR049C-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_05637
Sequence length 172
Comment | CAWG_05637 | Candida albicans WO1 conserved hypothetical protein (173 aa)
Sequence
MSLFRSLQNSPSTISIFHNSSIPLSNKLYDILEKAYDTQPEKPKHEFQIDLMKNKMPTYD
QYKLIVDKYLKGSTSKTILHNCFPFLHDSKTELYNSKGNVVTVKGVEWANKTFSPAEYQM
IYDTFNKLQESSDQSINTIASNVFQAPLVVDWDNDVIAGDEETLKAILSKYN
Download sequence
Identical sequences C4YTY9 G1UAZ9 Q9UVI8
5476.CAL0002595 CA4437 XP_716980.1.88832 CAWT_05637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]