SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_05664 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CAWT_05664
Domain Number - Region: 34-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00291
Family YKR049C-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_05664
Sequence length 222
Comment | CAWG_05664 | Candida albicans WO1 conserved hypothetical protein (223 aa)
Sequence
MLRSIIKSFKPSASFSSSIISPKSTTSLSTSSLKPLTVYHNSNLLVSHQLVAKLNNFNST
TDSPTNNKITFNLKTNEQLSESDYKFIIDECLYIHPDNKSILLQIFHNKYHMDKKKLIKD
FTLHDSIFEYNNLINNNKSYPLIIDYNHCLIANDDASFDRIMMNYLTCGIQNTTSSNSTT
ASHGFTTNGNSSSSGNGGNNSTGTVKYNDLVHPHMAEFADLF
Download sequence
Identical sequences C4YSW9
CAWT_05664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]