SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_00684 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_00684
Domain Number 1 Region: 11-170
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.16e-50
Family Glutathione peroxidase-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_00684
Sequence length 171
Comment | CAWG_00684 | Candida albicans WO1 glutathione peroxidase 2 (172 aa)
Sequence
MGNELLSTARIYTFKIPDAYNNVIDFDQFKNKVILIVNVASLCGFTPQYKELQLLYEKYH
ERGLEILGFPCNQFGNQEPLQEEEIVESCRRNFGVSFPIMKKTKVNIDCDGHESELYKYL
KSEKPGEVGFKGVRWNFEKFIVNRKGEVVARFNSLITPLQLEGFIEQLLSE
Download sequence
Identical sequences C4YDT6 Q59WD3
5476.CAL0001814 XP_713880.1.88832 CAWT_00684 CA4649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]