SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_01324 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_01324
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.03e-25
Family Thioltransferase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_01324
Sequence length 119
Comment | CAWG_01324 | Candida albicans WO1 glutaredoxin (120 aa)
Sequence
MFRTLLTKRLFNTSTMVSSQVKNKVEQLIKTKPVFIASKSYCPYCKATKSTIEAITKDAY
ILELDEVDDGAEIQEALLEITGQRTVPNVFIGGQHIGGNSDVQALKSSDKLDDKIKAAL
Download sequence
Identical sequences C4YFK6 Q5ABB1
CA4919 XP_719021.1.88832 5476.CAL0005151 CAWT_01324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]