SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_01870 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CAWT_01870
Domain Number - Region: 38-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00614
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_01870
Sequence length 279
Comment | CAWG_01870 | Candida albicans WO1 conserved hypothetical protein (280 aa)
Sequence
MRLNVVIRFTNSLSASEQVPDLSIPLSINYDVDDVNKLVNVVWLKTTIRSKVPQCANKRL
RLIYNGRVLNEKTDFKKEVLKPQLNLDQIYIHCVIGDELTREQLAQENQLDNKPQEVSTN
PEVIGFDRLLQQGFSQDDVTDLRRQFLSIYGSDNTSSGGDIADVEEDEHRQNRLRQLEER
WIESTSNNEAAGTANEQTPLTQDGDQAQAATTPSQPMDLDESRVNEDLLLGFCVGVFLGI
ISVVFLLADDSVFNKRQKMSIIAGLFINFSLAIVRGQWI
Download sequence
Identical sequences A0A1D8PSZ5 C4YLZ5
5476.CAL0005814 CA0806 XP_710162.1.88832 CAWT_01870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]