SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_01950 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_01950
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.65e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 89-212
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.28e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_01950
Sequence length 215
Comment | CAWG_01950 | Candida albicans WO1 conserved hypothetical protein (216 aa)
Sequence
MTLTLYTAPTGNGRKPLVFLKLLNIPHELHLFSWPTKDIKQDWYLKLNPQGLVPTLVDGE
LILPESNAILQYLAETYDKQGKFSYNLQTDPLEYWQQQKWLFYQATQFAGTLFRFNTYIG
IKADDGKVWDNILQSFADAYKVIDETLAQSEWFVGDKFTIVDIAFGVGNHRRIEVVARLG
LDKHFQDYDTKYPHVAQWYKKFLEVEGIKKALALK
Download sequence
Identical sequences C4YM72
CAWT_01950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]