SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_02294 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_02294
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.06e-36
Family Thioltransferase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_02294
Sequence length 103
Comment | CAWG_02294 | Candida albicans WO1 thioredoxin I (104 aa)
Sequence
MVHVVTEVNEFQTLLKENNLVIVDFFATWCGPCKMIAPLLEKFQNEYSNIKFLKIDVDQL
GSLAQEYNVSSMPTLILFKNGEEVNRVIGANPAAIKQALASLA
Download sequence
Identical sequences A0A1D8PU69 C4YN54
CAWT_02294 5476.CAL0000819 XP_719372.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]