SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_02383 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_02383
Domain Number 1 Region: 44-194
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.49e-29
Family Glutathione peroxidase-like 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAWT_02383
Sequence length 263
Comment | CAWG_02383 | Candida albicans WO1 conserved hypothetical protein (264 aa)
Sequence
MPELRRSARVAARPAKEPEAVTEQPPTKKVKTAPTNTAKPDAGLGIGEKIPDVTLLNQDG
EEISLTEVAKGSKYVVIFAFPRASTSGCARQVSGFRKLDKDYKDVSIFGVSSDSVKAQKN
FQTKQNAEYDLLSDPEKKLIGALGAKKHPSGIIRSHWIFVDGVLKVKQIQVSPEVSFTSA
EEEIKKFINENENGKEATENDVTKEEVKEESQQDDKEDNTEQTDEKATEQTQDEVKKVSD
ETKVEDETEEKPTEEQKTEAPVV
Download sequence
Identical sequences C4YPI2 Q5A7P9
CAWT_02383 5476.CAL0005188 XP_717789.1.88832 CA5773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]