SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_03233 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_03233
Domain Number 1 Region: 21-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000101
Family Selenoprotein W-related 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_03233
Sequence length 168
Comment | CAWG_03233 | Candida albicans WO1 conserved hypothetical protein (169 aa)
Sequence
MSDPTQSSTPSSSINLNINKYPRIIIQYCHQCKWQNRAIWYLQEFLQTFASSSTSEIKIY
DISIQPIFDFPGIFQIILQKESTNNKMETKIIYRRKFKNEEKYHNENQGDFVFDGFPDSK
FLKKLIKMELGPELSIGHHLEKYSDDNKLYDGNNNDKNDDCKDCKLES
Download sequence
Identical sequences C4YGQ2
CAWT_03233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]