SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_04629 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_04629
Domain Number 1 Region: 1523-1634
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000102
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_04629
Sequence length 1662
Comment | CAWG_04629 | Candida albicans WO1 conserved hypothetical protein (1663 aa)
Sequence
MNSTPSKLLPIDKHSHLQLQPQSSSASIFNSPTKPLNFPRTNSKPSLDPNSSSDTYTSEQ
DQEKGKEEKKDTAFQTSFDRNFDLDNSIDIQQTIQHQQQQPQQQQQLPQTDNNLIDEFSF
QTPMTSTLDLTKQNPTVDKMNENHAPTYINTSPNKSIMKKATPKVSPKKVAFTVTNPEIH
HYPDNRVEEEDQSQQKEDSVEPPSIQHQWKDPSQFNYSDEDTNASVPPTPPLHTTKPTFA
QLLNKNNEVNSEPEALTDMKLKHENFSNLSLDEKVNLYLSPTNNNNSKNVSDMDSHLQNL
QDASKNKTNENIHNLSFALKAPKNDIENPLNSLTNADISLRSSGSSQSSLQSLRDGNRVL
ESVPGSPKKVNPGLSLNDGIKGFSDEVVESLLPRDLSRDKLETTKEHDAPEHNNENFIDA
KSTNTNKGQLLVSSDDHLDSFDRSYNHTEQSILNLLNSASQSQISLNALEKQRQTQEQEQ
TQAAEPEEETSFSDNIKVKQEPKSNLEFVKVTIKKEPVSATEIKAPKREFSSRILRIKNE
DEIAEPADIHPKKENEANSHVEDTDALLKKALNDDEESDTTQNSTKMSIRFHIDSDWKLE
DSNDGDREDNDDISRFEKSDILNDVSQTSDIIGDKYGNSSSEITTKTLAPPRSDNNDKEN
SKSLEDPANNESSQQQLEVPHTKEDDSILANSSNIAPPEELTLPVVEANDYSSFNDVTKT
FDAYSSFEESLSREHETDSKPINFISIWHKQEKQKKHQIHKVPTKQIIASYQQYKNEQES
RVTSDKVKIPNAIQSKKFKEVNVMSRRVVSPDMDDLNVSQFLPELSEDSGFKDLNFANYS
NNTNRPRSFTPLSTKNVLSNIDNDPNVVEPPEPKSYAEIRNARRLSANKAAPNQAPPLPP
QRQPSSTRSNSNKRVSRFRVPTFEIRRTSSALAPCDMYNDIFDDFGAGSKPTIKAEGMKT
LPSMDKDDVKRILNAKKGVTQDEYINAKLVDQKPKKNSIVTDPEDRYEELQQTASIHNAT
MDSSIYGRPDSISTDMLPYLSDELKKPPTALLSADRLFMEQEVRHPLRSNSVLVHPGAGA
ATNSSMLPEPDFELINSPARNVSNNSDNVAISGNASTISFNQLDMNFDDQATIGQNIQEQ
PASKSANTVRGDDDGLASAPETPRTPTKKESISSKPAKLSSASPRKSPIKIGSPVRVIKK
NGSIAGIEPIPKATHKPKKSFQGNEISNHKVRDGGISPSSGSEHQQHNPSMVSVPSQYTD
ATSTVPDENKDVQHKPREKQKQKHHHRHHHHKQKTDIPGVVDDEIPDVGLQERGKLFFRV
LGIKNINLPDINTHKGRFTLTLDNGVHCVTTPEYNMDDHNVAIGKEFELTVADSLEFILT
LKASYEKPRGTLVEVTEKKVVKSRNRLSRLFGSKDIITTTKFVPTEVKDTWANKFAPDGS
FARCYIDLQQFEDQITGKALQFDLNCFNEWETMSNGNQPMKRGKPYKIAQLEVKMLYVPR
SDPREILPTSIRSAYESINELNNEQNNYFEGYLHQEGGDCPIFKKRFFKLMGTSLLAHSE
ISHKTRAKINLSKVVDLIYVDKENIDRSNHRNFSDVLLLDHAFKIKFANGELIDFCAPNK
HEMKIWIQNLQEIIYRNRFRRQPWVNLMLQQQQQQQQQSSQQ
Download sequence
Identical sequences C4YRD0
CAWT_04629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]