SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_04728 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_04728
Domain Number 1 Region: 658-791
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-28
Family Ran-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_04728
Sequence length 791
Comment | CAWG_04728 | Candida albicans WO1 hypothetical protein similar to nucleoporin (792 aa)
Sequence
MPNYSDGEPDVPAIASSDVLSRRKILKPKGRLGSNTTGASSNAFGAINKPPQSIFSFGGS
GNNAASGITPSQPAQSSNPFNFANKPESNTVNTASVDKDNKIKALNENFIQAITKLNVPN
TIADFTPIAQKYIDYYKSISKNETFSEIASKEVKEPVQPPPTSSFQFQPSNVSAPSAAAT
VTPFSFKPSAQSSESKSNGPVFSFNSNSQQQTTTKPAFSFNTPSSSITGSTTSAPPTFST
EPVSSSVPNEASKSETKRELINLDSDSESESDKEDSKTKEVKVQGPKFTLTSNPTTKSSP
FTFDPKKLAKKNAPDSDDSEDDVEIKGPTFQFNKPIQDSVFKLTSNNADNTSKLDEKKEE
EVKSTPLFGATTQDKDQATTSTGLFGFGQNKGGETKAPSLFGGSFGSNGNTTEQKPVSTF
SFGNSQNKTDSSANTETKKTETPSFSFGTTNSSSKPLFGSSNNEGNAKPAFTFGSTTDKK
DESASATATTTPSFSFGTQPNKTDSAKEAQGDKPATSLFGNSSDNANKPATTGFSFGAKT
QEDKSEAPKFVFGSSKANPFTFGASNNQGDSATTPSFNFGSNSSNNAFSFGSKPTGAFNF
AQKQEDQKNETSSTVTTSSSSFGSTKPAFAFPFGSAKPEDGPEEKKNEETVPEEETGGKF
EPVAKLSNEQVDSKSGEENETAKFTIRSKLMEYDSKNSENPYTNKGIGELKVLFNEQTKK
SRILIRADGSLRVLLNTLILSSVKYDSIGNGSLIRVPTIDADDSSKIITYVIKVKTPQDG
EQLLKCINELK
Download sequence
Identical sequences C4YRM6
CAWT_04728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]