SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_04936 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_04936
Domain Number 1 Region: 651-718,751-765,804-830
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000172
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Weak hits

Sequence:  CAWT_04936
Domain Number - Region: 511-598
Classification Level Classification E-value
Superfamily PH domain-like 0.000341
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_04936
Sequence length 832
Comment | CAWG_04936 | Candida albicans WO1 conserved hypothetical protein (833 aa)
Sequence
MKRKFSFFVVVFFCGFISTHSRMSTGEHSFTIPRSSYIASLLTVLGADALSNYGKGVFVG
GYPGIWHNDKPDLITELLTRKDTNERVLQYSNDNDLFFKKRDAIIKELRNDTTTADITSE
VSTIPVSLPKIKFEMPRPETKVNIDEQWIEEENKRFRKRLKRFAKKSTGGAIRASRSKIK
ASIFKSYEAGEIIRIDKVLVLVMKPPGSGRVSERWREYIAVLRKTDSVAEPLMLQFYDID
KSPEESHPRVGFRLNTQVKADFYSYLDKTISLTVLEKVQYILRLNNQTNSFRWLYFIKET
LGVETEINLFNIYVPRLGYFIEVEVPESVFANHFRSNQNIVVTKHEAGYEIECDGISQYL
KQFLPKGLSRGWFWFRKYDRLEWAGSTGEQLFIQNMLFSQNHQLEYREYEASDVPPRPIE
GFLGRLTNVSGKEKSVLRDFHKISYFYTNRNLLFFTKYYRAVPPPQGGDSLVNEVDLFGD
GHMEWLESDFDGHNKAIVEEIGRRTDMIVKAEGVIDMADICEVNISHSTQTQNLVHCALW
YSKPELASEKEIVDSCFEIQLKWGALIKLQAQNQAARDIWITSLNDMCRYWKRRQTETLA
NHIQISANNIERLSATQYADSNASDEINFLESQHAIACGASIPHLLPNMLVIKSGYLYEK
NKKHASFNHFYVVLCPGYLIIYHTFRRSRGTGTPKSTAFYEHYITIPLSQCYVYTGKLTE
LDLLNCETRTTQVDTHSVPRVYPDGWKSMEEDCELCFTLWFGKKRNISHYEKQLPKSLEV
GVQNEKNPGMVTMIRKLGITGKSIMFTANSRQERDRWTMCILSEMDRLTGQM
Download sequence
Identical sequences C4YS77
CAWT_04936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]