SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_05273 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_05273
Domain Number 1 Region: 71-228
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.92e-53
Family Glutathione peroxidase-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_05273
Sequence length 229
Comment | CAWG_05273 | Candida albicans WO1 conserved hypothetical protein (230 aa)
Sequence
MVKSNVESAWETMEDTFSEIQNKFHQIYKPIDTGKPDEDDETTKKESLDITDDSTLSVSP
ITQLLYLARSKFYDLTPLDNQKSPFPFKNLRGKVVLIVNVASRCGFSFQYNGLEQLNKRF
ANDDFVLLGVPCNQFLWQEPGTNDQIVTKCKKKYDVSFQILDKINVNGEQADPVYKFLKA
QKEGLWGTNRVKWNFEKFLIDKNGRVVERYSTFTRPVAIIPKIEQLLES
Download sequence
Identical sequences A0A1D8PPH4
XP_714296.2.88832 CAWT_05273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]