SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAWT_05558 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_05558
Domain Number 1 Region: 63-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 2e-30
Family Thioltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAWT_05558
Sequence length 156
Comment | CAWG_05558 | Candida albicans WO1 glutaredoxin (157 aa)
Sequence
MDYFQTEKTTETRQQRQQKKRPVRNSIICTLSLSYQPNFVMSSLIGWLSSWFQNEPITPE
LKKEIESNINSHKVLVYSKSYCPYCTSTKTLLQSLNQDYKVIELDQIPKGSAIQNGLQEL
TGQRTVPNVFINGKHIGGNSDIQALHSQGKLKPLFG
Download sequence
Identical sequences C4YTR3 G1UAU6 Q5AH29
XP_721347.1.88832 5476.CAL0003046 CA4964 CAWT_05558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]