SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_00299 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_00299
Domain Number 1 Region: 672-1028
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.46e-105
Family Myotubularin-like phosphatases 0.000000132
Further Details:      
 
Domain Number 2 Region: 1082-1481
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.3e-60
Family Glycosyl transferases group 1 0.00058
Further Details:      
 
Domain Number 3 Region: 3-170
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-21
Family Ypt/Rab-GAP domain of gyp1p 0.0021
Further Details:      
 
Domain Number 4 Region: 212-347
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-21
Family Ypt/Rab-GAP domain of gyp1p 0.0043
Further Details:      
 
Domain Number 5 Region: 520-663
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000344
Family GRAM domain 0.035
Further Details:      
 
Domain Number 6 Region: 399-482
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000466
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_00299
Sequence length 1488
Comment | PITT_00299 | Phytophthora infestans conserved hypothetical protein (translation) (1488 aa)
Sequence
MESRGARWAAAFGLQGDVLAAQRERYERLKQHMVFQIDATGITDPLTAFAAANGSPSANS
SSWSQYFTDETLLEEINTDLERLYPAGNESFFQNELYLSTLRHVLFVWCRLHPDVAYRQG
MHDVVAVVLYAFLQTTKEGNTEEDQVKNLPNQPEADTFLVFEAVMLFLKPFYEIIKTRRN
TARDNEDSRRLFASFSLKESESSNGHETQPALHRLCHHIQFELLQQKDPQLYYQLQNLEI
VPETYCLRWIRLLFAREYALKELLWVWDAMILDNSRADVIFPVINMTVKSDNDLLQLPKL
ACKSEDTNWTGFPLLRYVCVARLLQLSSELRQSDNTGCLRLLMRTYQGEELDGEENRAVE
LMNFAKVLQDPMAEEQQQSASDVANSDKGSSSVKVVQFKEGSLGIVLTGAAAPYDDRLAV
KSFTRDPNATDGVGQAEASGKVRLGDLLQSINGVPIVGVTTEEVKRRLQLINRPVYIGFC
HCSDVYAAVSDGSEAIGSSDAAGSSPRSETALSELVLPVFLPGELCYANVETSMQRLVLS
HDGSCQSHYISGKLFITNYRCFFTRLLGRGEIDWQIPVLSITSIDRINPRDNSTTAAATL
SVENAQVALGFAPDDSFKVVIRCKDLQVARLSIADQSEYSKLVKCLSFLAFPQSLLDAFC
FAYAPTVAPSEEVQFDIRQEYKRIGLLSFPGHLRCIDQSVTYTLCETYPRHLIVPADISD
VRLKAAAAFRAHQRLPVVSWIHRGNGATIVRSSQPLVGLKSARSGEDELLVTLSCCSSNK
KAFGRYVIMDARSQLAAVGNKALGKGTEISSNYRGAKLIFMNVENIHSVRQSQLALAATF
EPKKSASEDTSSSFYGRIDSSGWLRHVRLVLEASVELAHTVHNAQMVALAELMLDPYYRT
LRGFQILVEKEWCAFGHQFALRSGHARSDVSNEQRSPVFLLWLDCVWQYIRQYPTECEFN
ESFLLTLADHVYSCKFGTFMFDCERQRKDFFAKHRVFSVWSEINTQSERFTNHMYAPSEQ
ATVLSPSTLSKNIKPMALPPPPALAAIVAPWVLVLIFVVWGFFRGLNCSIPRPVRQSKET
KKLRVGFVHPDFGIGGAENLVVNAAVALQQRGAHVTVFTAHHDVNHCFEETRGDGPLAAH
VRVHGDWLPRTILGKLYALCAVVRVLFVTLCIAISYINDVDVFVVDQVSISIPFLRALGK
PVLFYGHFPDKLLCIRSDSPWKRMYRIPLDYLEEITTAASDIIVANSKFSREVFQKVFPR
LRSKKLGILYPPVDVKAYEATAEADVQRDSGLFVSLNRFERKKNVALAIEALVELRTRLP
SDEFQRVKLIVAGGYDPLNTENKEHLIELQAVVVKHGLKEHVEFRTSVSNSMKLELLRKA
HGILYTPDREHFGIVPVEAMACGTPVIAVSSGGPLESIADGETGFLCQQKPEAFAEAMAK
LCGPKNSTKVVEMSACGRLRAQKLFSLETFGDTLLELVNQAVYGEKAA
Download sequence
Identical sequences D0MQG2
XP_002908917.1.21288 PITG_00299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]