SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_00385 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_00385
Domain Number 1 Region: 520-618,646-733
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-29
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 708-809
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.04e-21
Family Ypt/Rab-GAP domain of gyp1p 0.0098
Further Details:      
 
Domain Number 3 Region: 38-224
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000309
Family BAR domain 0.033
Further Details:      
 
Weak hits

Sequence:  PITG_00385
Domain Number - Region: 485-537
Classification Level Classification E-value
Superfamily F-box domain 0.00181
Family F-box domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_00385
Sequence length 840
Comment | PITT_00385 | Phytophthora infestans conserved hypothetical protein (translation) (840 aa)
Sequence
MLQVLRRKIGRYAPRGGVKETPEEEEELIPLKDNATCFEAAVWHFTRQDRALRRLEKRLT
QMLDQIQVACATMATVAEIFSDTCSAEEENCVGEDYRSAMKQIELQEAERMEQSIRFTVL
DPLQARLERYEHLRAEINAWDKLAAESKMLREVIMKMQSSSLEDDDKRAHTEQNLHRVAA
ALQEVEALLLPQLELANESGAANFMDLFSTTRLQTAIFFRNANETVLSSLLSSEKEILAE
ANQPLKIPATVNNTPCCVSLSVSSKLTKMSSSTSDAWTEVDGSNSSTAPDGVETVSGSDE
DDESTGLSITFEDFEAGKIVPHLHKCEDGVAMEQITAKPSKLVTLTTYSVGSEDKQAGGS
QSSRIRRSTSPSPRTASFKPITPRRTVSMLSSIRKTIQGKLSYATGETRIIRQSSAPTSS
TNSLSTSGEQLLLPQSATEWLAIEDCLWEIDVREAKSPGKSLLPAQSVTSTDDLLYGLLQ
KNDTLYFECLSYLRVEDLARLSKVNFRLHSHLVDSAPIWKKCIRSGGLSPAIRSSLWLSV
FYESTPWRSSAIASHYLSADRRCNMYAQLLTKVETKLVDGIADGLPVSDDDAQLAVWFRE
IDVDVVRTCHRSIHARKSMVNTRVELATSDGQDAIEDSVTSILNEIMDSILRRVLRAYVV
YNPRVGYCQGMGFLVRLLAEVAEDEADIFWLFVGFSEPENDRNLYEPGMAVLQPYLSKFE
ELFSTHMPELHMHFQKEGVHVATFCTRWFLTFFSSFETLAPTLVTRLLDIFIIDGWRIMF
SVSLVILDELQQQLLKADMEGILRVLQFPRCYMPEPDHSRQQQLVRHALAFSISRAINSI
Download sequence
Identical sequences D0MQN4
PITG_00385 XP_002908989.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]