SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_01640 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_01640
Domain Number 1 Region: 549-663
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000194
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 2 Region: 108-181
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000598
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 498-572
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000994
Family Ypt/Rab-GAP domain of gyp1p 0.024
Further Details:      
 
Weak hits

Sequence:  PITG_01640
Domain Number - Region: 285-324
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0248
Family Ypt/Rab-GAP domain of gyp1p 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_01640
Sequence length 1196
Comment | PITT_01640 | Phytophthora infestans predicted protein (translation) (1196 aa)
Sequence
MKELRHYDTFKDVNTLLMSTPKGVISMTDATGICCFTPVPMAGRRPLKFNRSDTNDSRPG
AYDQKFAVLTPLHMNLLAFHNGREWSGASESQQGLSLLASLSAFYPTVDVLHSGWMTKRR
ERNVHSPKSIMTYWKRHFFVFLTSGDLLYFRDDTLSELQGRVDVRHAPTVRVTGEQLLEE
RKKDGGMFKFGKMPALERETCLIWIATPPSKMFVLKLEDDHDETGSGASGKVALGSSSGV
GVTTRKAELTPSSKKWLLLLLQGHAETKYTQLEKCIATSKYGLTTEIISAVRAGIPDELR
GQLWKGFSGATDLQRRVELKHAIRSASKSSNVFRMPSRENSVRSGHKSPASKKHAVYEMC
SAGIDAKKMDPPENQMLFTRLCALALQESGHAAVTARTSELNNLSGRLGRAISDASNPSD
QYSEDRGSSYDEERDSMDDDDAEQFEVEETKTGNDPFRRRPSARNTLKQLEKGKMGNYVY
PSDYPAADWELTSRRRLLIASSRYNPYSHPFPWRVSCLLLAYVEEESAFWIINSIIDSLL
PGYFHGYRPALQIDVAAFTTLLESRLPTLAAHLAALKFPLGRLVERWFLSLFTASLIPLP
MVLRIWDAFFIRGVIVFYGVGIAFLFRAEKTLFHAKTAAEAEEYLRASERSCIDADAVFS
VVFKDDLTIPWLTDEQLEKLRSTQRHRVMEQVSQKVGYFKDKLSILKLSQDLGSRCQAVA
KQFLSDRRGVTAALRLSEAQTSDEQDPYDMYGLDDDINDLDIGIDGDKLEDSFQMTLHLL
LEQVRESSAAAEALAVELGQRQAKWLAASSQLAACPLAQPPTPDSHSWLSQVKQGKIAGA
GHDASSLFAASGDGFPSASRVIEASGMMFDTGEARLPSNGASESGNDSPITGQRSCLLME
REDLGLSDRNLAEMFLYALVSSLKALCAVRLECLGVTYRFMWHGGSWLESAVDYPSFSSL
AETASTPSTPNSRQSVRVKSQSSTASSSKRRPRAMDDSALSGRKRGDSGATTPKRGGRPT
TRSFYNPSKSPTRLRPSLSSGDFSVLEFATGGVGTNLYDDPIIEGQPAPSSPTYTEQLAD
ASDSYPASPTSLSPHDSSAVGLDFTLGRGIDRCAASTLDTLNKPLLATLTAQHQDGERVF
RESHKRLLSGLGKFLRLEYHDQDWALRERALTIERELQQELQEIEAEVHGAQWLQH
Download sequence
Identical sequences D0MTQ3
XP_002908267.1.21288 PITG_01640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]