SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_01651 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_01651
Domain Number 1 Region: 43-180
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.7e-19
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITG_01651
Sequence length 194
Comment | PITT_01651 | Phytophthora infestans hypothetical protein (translation) (194 aa)
Sequence
MLPFGCHGEKWLFLVRKRQSFVVPTDITGDDYQWLVHNLSKQRRLQGTRLEQKRTLDRDV
DRTFHQLQIRMVNSRLSSFLSKHQYSSSDIKTWRSSTHQLLSVFLMLKPQIGYCQGMTSV
AAVLVQESKMNSEIAFRLFLALSEKYRLDDVYRPDMKDVNLRYFQLDEALRLHLPRLHAH
MSDRDIHPSTYASW
Download sequence
Identical sequences D0MTR4
XP_002908278.1.21288 PITG_01651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]