SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITG_01821 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_01821
Domain Number 1 Region: 106-271
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-42
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 2 Region: 247-348
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.07e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITG_01821
Sequence length 372
Comment | PITT_01821 | Phytophthora infestans conserved hypothetical protein (translation) (372 aa)
Sequence
MLEKNATAVNPEDAECSGIKSDANPETQPPPRPDEAGTKVEELKSKTSAVAFLLSPVDRY
GFLVTDKRYNGGHTAATHKHAVWLENRRTQKWVKMIGKQLEDWEVCQLRNAATLKKRIRK
GIPEALRGRVWSHLAGSSQMLLNNPGAYHQLLQTTQVPCEETIARDIGRTFPKHSLFRDR
SSLGQCALMNVLKAYSLHDPEVGYCQGMGFLTAMFLCYMPEQQAFWLLVACLNHKRYGLA
DLYRPRMPKVPEVTFIFEGLFKQLMPQLSAHLENEGLHPTMYLTQWFLTLFTYNFPFEFV
TRVWDAFLHEGWKVIYRVALALMKLSQKTLLSSKFELIMEYFRELPNKVRALKAPGGCNC
AHDAFMRLGGYR
Download sequence
Identical sequences D0MU62
XP_002908426.1.21288 PITG_01821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]